Integrin alpha E/CD103 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha E/CD103 Antibody [NBP1-88142] - Staining of human small intestine shows strong membranous positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Integrin alpha E/CD103 Antibody [NBP1-88142] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Integrin alpha E/CD103 Antibody [NBP1-88142] - Staining of human endometrium shows no positivity in glandular cells.

Immunohistochemistry-Paraffin: Integrin alpha E/CD103 Antibody [NBP1-88142] - Staining of human duodenum shows strong membranous positivity in lymphoid cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha E/CD103 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGAE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH6 retrieval is recommended.
• Control Peptide:

  Integrin alpha E/CD103 Protein (NBP1-88142PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha E/CD103 Antibody - BSA Free

• antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide
• CD103 antigen
• CD103
• HML-1 antigen
• HUMINAE
• Integrin alpha E
• integrin alpha-E
• Integrin alpha-IEL
• integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide)
• ITGAE
• MGC141996
• Mucosal lymphocyte 1 antigen

Background

CD103 is a member of the integrin series of adhesion molecules. This antigen defines a developmentally important subset of T cells, namely mucosal T cells including all IEL (intraepithelial lymphocytes) and approx. 20% of lamina propria T cells. Expression of CD103 is more restricted outside these mucosal organs, appearing at lower levels on T cell subsets of the lymph node, dendritic epidermis and periphery. In non-epithelial CD103+ T cells there is a bias toward expression on CD8+.cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha E/CD103 Antibody (NBP1-88142)(2)

Publications using NBP1-88142

• Fardoos R, Nyquist SK, Asowata OE et al. HIV specific CD8+ TRM-like cells in tonsils express exhaustive signatures in the absence of natural HIV control Frontiers in immunology 2022-10-18 [PMID: 36330531] (MI, Human)
• Green KY, Kaufman SS, Nagata BM et al. Human norovirus targets enteroendocrine epithelial cells in the small intestine Nat Commun 2020-06-02 [PMID: 32488028] (IF/IHC, Human)
  
  Details:
  Citation using the Biotin format of this antibody.

Bioinformatics

• Gene Symbol: ITGAE
• Entrez:
  • 3682(Human)
• Uniprot:
  • P38570(Human)