Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining in human placenta and liver tissues . Corresponding ITGA6 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human rectum shows strong membranous positivity in glandular cells.
Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Simple Western lane view shows a specific band for ITGA6 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under ...read more
Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Electropherogram image(s) of corresponding Simple Western lane view. Integrin alpha 6/CD49f antibody was used at 1:50 dilution on RT-4 and U-251MG sp ...read more
Analysis in human cell lines A-431 and MCF-7 using Anti-ITGA6 antibody. Corresponding ITGA6 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Novus Biologicals Rabbit Integrin alpha 6/CD49f Antibody - BSA Free (NBP1-85747) is a polyclonal antibody validated for use in IHC, WB, Simple Western and IP. Anti-Integrin alpha 6/CD49f Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunoprecipitation Reported in scientific literature (PMID: 23888051)
Simple Western 1:50
Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG sp, separated by Size, antibody dilution of 1:50, apparent MW was 168 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
127 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Mouse reactivity reported in the scientific literature (PMID: 23888051). Rat (86%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Integrin alpha 6/CD49f Antibody - BSA Free
CD49 antigen-like family member F
CD49f antigen
CD49f
DKFZp686J01244
FLJ18737
Integrin alpha 6
integrin alpha-6
integrin alpha6B
integrin, alpha 6
ITGA6
ITGA6B
Platelet gpl
VLA-6
Background
The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Crestani M, Kakogiannos N, Iannelli F et al. SP2G: an imaging and analysis pipeline revealing the inter and intra-patient migratory diversity of glioblastoma bioRxiv 2023-02-24 (WB)
Reviews for Integrin alpha 6/CD49f Antibody (NBP1-85747) (0)
There are no reviews for Integrin alpha 6/CD49f Antibody (NBP1-85747).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Integrin alpha 6/CD49f Antibody - BSA Free and receive a gift card or discount.