Integrin alpha 6/CD49f Antibody

Images

 
Western Blot: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Analysis in human cell line HeLa.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human rectum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Simple Western lane view shows a specific band for ITGA6 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under ...read more
Simple Western: Integrin alpha 6/CD49f Antibody [NBP1-85747] - Electropherogram image(s) of corresponding Simple Western lane view. Integrin alpha 6/CD49f antibody was used at 1:50 dilution on RT-4 and U-251MG sp ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 6/CD49f Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:50
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunoprecipitation 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunoprecipitation reported in scientific literature (PMID: 23888051).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Integrin alpha 6/CD49f Protein (NBP1-85747PEP)
Publications
Read Publications using
NBP1-85747 in the following applications:

  • IHC
    1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23308131)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 6/CD49f Antibody

  • CD49 antigen-like family member F
  • CD49f antigen
  • CD49f
  • DKFZp686J01244
  • FLJ18737
  • Integrin alpha 6
  • integrin alpha-6
  • integrin alpha6B
  • integrin, alpha 6
  • ITGA6
  • ITGA6B
  • Platelet gpl
  • VLA-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
796-IC
Species: Mu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5248
Species: Hu
Applications: IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-48514
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 6/CD49f Antibody (NBP1-85747)(4)

Reviews for Integrin alpha 6/CD49f Antibody (NBP1-85747) (0)

There are no reviews for Integrin alpha 6/CD49f Antibody (NBP1-85747). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 6/CD49f Antibody (NBP1-85747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 6/CD49f Products

Bioinformatics Tool for Integrin alpha 6/CD49f Antibody (NBP1-85747)

Discover related pathways, diseases and genes to Integrin alpha 6/CD49f Antibody (NBP1-85747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 6/CD49f Antibody (NBP1-85747)

Discover more about diseases related to Integrin alpha 6/CD49f Antibody (NBP1-85747).
 

Pathways for Integrin alpha 6/CD49f Antibody (NBP1-85747)

View related products by pathway.

PTMs for Integrin alpha 6/CD49f Antibody (NBP1-85747)

Learn more about PTMs related to Integrin alpha 6/CD49f Antibody (NBP1-85747).
 

Research Areas for Integrin alpha 6/CD49f Antibody (NBP1-85747)

Find related products by research area.

Blogs on Integrin alpha 6/CD49f

There are no specific blogs for Integrin alpha 6/CD49f, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 6/CD49f Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA6
Entrez
Uniprot