Integrin alpha 3/CD49c Antibody

Images

 
Orthogonal Strategies: Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in human cell lines U-251MG and HEK293 using anti-ITGA3 antibody. Corresponding ITGA3 RNA-seq data are presented for ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining in human lung and skeletal muscle tissues. Corresponding ITGA3 RNA-seq data are presented for the same ...read more
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in human cell line U-87 MG.
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining of human lung cancer shows strong membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Integrin alpha 3/CD49c Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Specificity
Specificity of human, rat Integrin alpha 3/CD49c antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

Reactivity Notes

Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 3/CD49c Antibody

  • antigen identified by monoclonal J143
  • CD49 antigen-like family member C
  • CD49c antigen
  • CD49c
  • FLJ34631
  • FLJ34704
  • FRP-2
  • Galactoprotein B3
  • GAP-B3
  • GAPB3CD49C
  • Integrin alpha 3
  • integrin alpha-3
  • integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
  • ITGA3
  • MSK18
  • VCA-2
  • very late activation protein 3 receptor, alpha-3 subunit
  • VL3A
  • VLA-3 subunit alpha
  • VLA3a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
BBA37
Species: Hu
Applications: AdBlk
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP2-48514
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no publications for Integrin alpha 3/CD49c Antibody (NBP2-48514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no reviews for Integrin alpha 3/CD49c Antibody (NBP2-48514). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Discover related pathways, diseases and genes to Integrin alpha 3/CD49c Antibody (NBP2-48514). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Discover more about diseases related to Integrin alpha 3/CD49c Antibody (NBP2-48514).
 

Pathways for Integrin alpha 3/CD49c Antibody (NBP2-48514)

View related products by pathway.

PTMs for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Learn more about PTMs related to Integrin alpha 3/CD49c Antibody (NBP2-48514).

Blogs on Integrin alpha 3/CD49c

There are no specific blogs for Integrin alpha 3/CD49c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3/CD49c Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3
Entrez