Integrin alpha 3/CD49c Antibody (NBP2-48514)

Images

 
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Immunohistochemical staining of human lung cancer shows strong membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Immunohistochemical staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Immunohistochemical staining of human urothelial cancer shows strong membranous positivity in tumor cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 3/CD49c Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Reactivity Notes

Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 3/CD49c Antibody

  • antigen identified by monoclonal J143
  • CD49 antigen-like family member C
  • CD49c antigen
  • CD49c
  • FLJ34631
  • FLJ34704
  • FRP-2
  • Galactoprotein B3
  • GAP-B3
  • GAPB3CD49C
  • Integrin alpha 3
  • integrin alpha-3
  • integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
  • ITGA3
  • MSK18
  • VCA-2
  • very late activation protein 3 receptor, alpha-3 subunit
  • VL3A
  • VLA-3 subunit alpha
  • VLA3a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2405
Species: Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BBA37
Species: Hu
Applications: AdBlk
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no publications for Integrin alpha 3/CD49c Antibody (NBP2-48514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no reviews for Integrin alpha 3/CD49c Antibody (NBP2-48514). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 3/CD49c Antibody (NBP2-48514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 3/CD49c Antibody Products

Related Products by Gene

Bioinformatics Tool for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Discover related pathways, diseases and genes to Integrin alpha 3/CD49c Antibody (NBP2-48514). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Discover more about diseases related to Integrin alpha 3/CD49c Antibody (NBP2-48514).
 

Pathways for Integrin alpha 3/CD49c Antibody (NBP2-48514)

View related products by pathway.

PTMs for Integrin alpha 3/CD49c Antibody (NBP2-48514)

Learn more about PTMs related to Integrin alpha 3/CD49c Antibody (NBP2-48514).

Blogs on Integrin alpha 3/CD49c

There are no specific blogs for Integrin alpha 3/CD49c, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3/CD49c Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3
Entrez

Customers Who Bought This Also Bought