INT2 Antibody

Images

 
Western Blot: INT2 Antibody [NBP2-83080] - Host: Rabbit. Target Name: INTS2. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INT2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human INT2. Peptide sequence: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
INTS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INT2 Antibody

  • Int2
  • integrator complex subunit 2
  • KIAA1287INT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-509
Species: Hu, Mu
Applications: WB, IP
NBP2-16689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-97475
Species: Hu, Mu, Rt, Ma, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP2-76871
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB6860
Species: Hu
Applications: WB, IP
NBP2-99299
Species: Hu
Applications: WB, ICC/IF
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB100-314
Species: Hu
Applications: WB, IP
NBP2-55735
Species: Hu
Applications: WB, ICC/IF
NBP2-83080
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for INT2 Antibody (NBP2-83080) (0)

There are no publications for INT2 Antibody (NBP2-83080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INT2 Antibody (NBP2-83080) (0)

There are no reviews for INT2 Antibody (NBP2-83080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INT2 Antibody (NBP2-83080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional INT2 Products

Array NBP2-83080

Bioinformatics Tool for INT2 Antibody (NBP2-83080)

Discover related pathways, diseases and genes to INT2 Antibody (NBP2-83080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on INT2

There are no specific blogs for INT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS2