INTS1 Antibody

Images

 
Immunohistochemistry-Paraffin: INTS1 Antibody [NBP1-85066] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INTS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INTS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INTS1 Protein (NBP1-85066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INTS1 Antibody

  • DKFZp586J0619
  • FLJ46624
  • integrator complex subunit 1
  • NET28
  • UNQ1821/PRO3434

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-19091
Species: Hu, Mu
Applications: WB, IP
AF1620
Species: Mu
Applications: WB, IHC
NBP2-46367
Species: Hu
Applications: WB, IHC
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-60660
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-44179
Species: Mu
Applications: WB, ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP1-85066
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for INTS1 Antibody (NBP1-85066) (0)

There are no publications for INTS1 Antibody (NBP1-85066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INTS1 Antibody (NBP1-85066) (0)

There are no reviews for INTS1 Antibody (NBP1-85066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INTS1 Antibody (NBP1-85066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INTS1 Products

Bioinformatics Tool for INTS1 Antibody (NBP1-85066)

Discover related pathways, diseases and genes to INTS1 Antibody (NBP1-85066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INTS1 Antibody (NBP1-85066)

Discover more about diseases related to INTS1 Antibody (NBP1-85066).
 

Pathways for INTS1 Antibody (NBP1-85066)

View related products by pathway.

Blogs on INTS1

There are no specific blogs for INTS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INTS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS1