Recombinant Human INPP1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human INPP1 Protein [H00003628-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human INPP1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 300-399 of Human INPP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
INPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human INPP1 GST (N-Term) Protein

  • EC 3.1.3.57
  • inositol polyphosphate 1-phosphatase
  • inositol polyphosphate-1-phosphatase
  • IPP
  • IPPase
  • MGC110984

Background

INPP1 - inositol polyphosphate-1-phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85445
Species: Hu
Applications: IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-89110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
MAB6257
Species: Hu, Mu, Rt
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB1936
Species: Hu
Applications: IP, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00003628-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for INPP1 Partial Recombinant Protein (H00003628-Q01) (0)

There are no publications for INPP1 Partial Recombinant Protein (H00003628-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP1 Partial Recombinant Protein (H00003628-Q01) (0)

There are no reviews for INPP1 Partial Recombinant Protein (H00003628-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP1 Partial Recombinant Protein (H00003628-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INPP1 Products

Bioinformatics Tool for INPP1 Partial Recombinant Protein (H00003628-Q01)

Discover related pathways, diseases and genes to INPP1 Partial Recombinant Protein (H00003628-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP1 Partial Recombinant Protein (H00003628-Q01)

Discover more about diseases related to INPP1 Partial Recombinant Protein (H00003628-Q01).
 

Pathways for INPP1 Partial Recombinant Protein (H00003628-Q01)

View related products by pathway.

Research Areas for INPP1 Partial Recombinant Protein (H00003628-Q01)

Find related products by research area.

Blogs on INPP1

There are no specific blogs for INPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human INPP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP1