Importin-8 Antibody

Images

 
Immunohistochemistry-Paraffin: Importin-8 Antibody [NBP1-87879] - Staining of human kidney shows moderate granular cytoplasmic positivity in tubular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Importin-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIGLSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IPO8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Importin-8 Protein (NBP1-87879PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Importin-8 Antibody

  • FLJ21954
  • FLJ26580
  • Imp8
  • importin 8
  • importin-8
  • RAN binding protein 8
  • Ran-binding protein 8
  • RanBP8
  • RANBP8imp8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27150
Species: Hu, Pm
Applications: WB, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89507
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003843-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for Importin-8 Antibody (NBP1-87879) (0)

There are no publications for Importin-8 Antibody (NBP1-87879).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-8 Antibody (NBP1-87879) (0)

There are no reviews for Importin-8 Antibody (NBP1-87879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Importin-8 Antibody (NBP1-87879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin-8 Products

Bioinformatics Tool for Importin-8 Antibody (NBP1-87879)

Discover related pathways, diseases and genes to Importin-8 Antibody (NBP1-87879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin-8 Antibody (NBP1-87879)

Discover more about diseases related to Importin-8 Antibody (NBP1-87879).
 

Pathways for Importin-8 Antibody (NBP1-87879)

View related products by pathway.

PTMs for Importin-8 Antibody (NBP1-87879)

Learn more about PTMs related to Importin-8 Antibody (NBP1-87879).

Blogs on Importin-8

There are no specific blogs for Importin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO8