Karyopherin (importin) beta 3 Antibody (1C4)

Images

 
Western Blot: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - RANBP5 monoclonal antibody (M01), clone 1C4. Analysis of IPO5 expression in Raw 264.7.
Immunohistochemistry-Paraffin: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - Analysis of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Western Blot: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - RANBP5 monoclonal antibody (M01), clone 1C4 Analysis of RANBP5 expression in HeLa.
Western Blot: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - RANBP5 monoclonal antibody (M01), clone 1C4. Analysis of IPO5 expression in PC-12.
Western Blot: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - Analysis of IPO5 expression in transfected 293T cell line by RANBP5 monoclonal antibody (M01), clone 1C4.Lane 1: IPO5 transfected lysate ...read more
ELISA: Karyopherin (importin) beta 3 Antibody (1C4) [H00003843-M01] - Detection limit for recombinant GST tagged RANBP5 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Karyopherin (importin) beta 3 Antibody (1C4) Summary

Immunogen
RANBP5 (AAH01497, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
Localization
Cytoplasmic and Nuclear. Note=Found particularly in the nuclear rim and nucleolus.
Specificity
RANBP5 - RAN binding protein 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IPO5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00003843-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Karyopherin (importin) beta 3 Antibody (1C4)

  • DKFZp686O1576
  • FLJ43041
  • IMB3
  • imp5
  • importin 5
  • importin beta-3 subunit
  • Importin subunit beta-3
  • importin-5
  • karyopherin (importin) beta 3
  • Karyopherin beta-3
  • KPNB3
  • MGC2068
  • RAN binding protein 5
  • Ran_GTP binding protein 5
  • Ran-binding protein 5
  • RANBP5

Background

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-27150
Species: Hu, Pm
Applications: WB, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NB100-93322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for Karyopherin (importin) beta 3 Antibody (H00003843-M01)(2)

Reviews for Karyopherin (importin) beta 3 Antibody (H00003843-M01) (0)

There are no reviews for Karyopherin (importin) beta 3 Antibody (H00003843-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Karyopherin (importin) beta 3 Antibody (H00003843-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Karyopherin (importin) beta 3 Products

Bioinformatics Tool for Karyopherin (importin) beta 3 Antibody (H00003843-M01)

Discover related pathways, diseases and genes to Karyopherin (importin) beta 3 Antibody (H00003843-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Karyopherin (importin) beta 3 Antibody (H00003843-M01)

Discover more about diseases related to Karyopherin (importin) beta 3 Antibody (H00003843-M01).
 

Pathways for Karyopherin (importin) beta 3 Antibody (H00003843-M01)

View related products by pathway.

Blogs on Karyopherin (importin) beta 3

There are no specific blogs for Karyopherin (importin) beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Karyopherin (importin) beta 3 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO5
Entrez
OMIM
Uniprot