IMPDH1 Antibody - BSA Free

Western Blot: IMPDH1 Antibody [NBP1-52933] - Titration: 1 ug/ml Positive Control: Hela cell lysate.

Immunohistochemistry-Paraffin: IMPDH1 Antibody [NBP1-52933] - Human Pancreas.

Immunohistochemistry-Paraffin: IMPDH1 Antibody [NBP1-52933] - Human Colon Tissue, antibody concentration 5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IMPDH1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IMPDH1(IMP (inosine monophosphate) dehydrogenase 1) The peptide sequence was selected from the middle region of IMPDH1. Peptide sequence KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMPDH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IMPDH1 Antibody - BSA Free

• DKFZp781N0678
• EC 1.1.1.205
• IMP (inosine 5'-monophosphate) dehydrogenase 1
• IMP (inosine monophosphate) dehydrogenase 1
• IMP Dehydrogenase 1
• IMPD 1
• IMPD
• IMPD1
• IMPDH 1
• IMPDH1
• IMPDH-I
• inosine-5'-monophosphate dehydrogenase 1
• LCA11
• LCA11RP10
• retinitis pigmentosa 10 (autosomal dominant)
• RP10
• sWSS2608

Background

IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IMPDH1 Antibody (NBP1-52933)(1)

Publication using NBP1-52933

• Taylor HE, Calantone N, Lichon D et al. mTOR Overcomes Multiple Metabolic Restrictions to Enable HIV-1 Reverse Transcription and Intracellular Transport Cell Rep 2020-06-23 [PMID: 32579936] (WB, Human)

FAQs for IMPDH1 Antibody (NBP1-52933). (Showing 1 - 1 of 1 FAQ).

1. Do you have a kit for measuring IMPDH activity?
   • We currently do not have any kits to measure IMPDH activity, however we have a number of IMPDH antibody pairs that can be used for WB/IP and ELISA.

Bioinformatics

• Gene Symbol: IMPDH1
• Uniprot:
  • P20839()