STK19 Antibody

Images

 
Immunohistochemistry-Paraffin: STK19 Antibody [NBP1-84308] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STK19 Protein (NBP1-84308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STK19 Antibody

  • D6S60
  • D6S60E
  • EC 2.7.11.1
  • G11nuclear serine/threonine protein kinase
  • HLA-RP1
  • MGC117388
  • MHC class III HLA-RP1
  • Protein G11
  • Protein RP1
  • RP1serine/threonine-protein kinase 19
  • serine/threonine kinase 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80698
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for STK19 Antibody (NBP1-84308) (0)

There are no publications for STK19 Antibody (NBP1-84308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK19 Antibody (NBP1-84308) (0)

There are no reviews for STK19 Antibody (NBP1-84308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STK19 Antibody (NBP1-84308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK19 Products

Bioinformatics Tool for STK19 Antibody (NBP1-84308)

Discover related pathways, diseases and genes to STK19 Antibody (NBP1-84308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK19 Antibody (NBP1-84308)

Discover more about diseases related to STK19 Antibody (NBP1-84308).
 

Pathways for STK19 Antibody (NBP1-84308)

View related products by pathway.

PTMs for STK19 Antibody (NBP1-84308)

Learn more about PTMs related to STK19 Antibody (NBP1-84308).
 

Research Areas for STK19 Antibody (NBP1-84308)

Find related products by research area.

Blogs on STK19

There are no specific blogs for STK19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK19