IMMP1L Antibody - BSA Free

Immunohistochemistry-Paraffin: IMMP1L Antibody [NBP2-68738] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IMMP1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMMP1L
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  IMMP1L Recombinant Protein Antigen (NBP2-68738PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for IMMP1L Antibody - BSA Free

• EC 3.4.21.-
• FLJ25059
• IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae)
• IMP1
• IMP1-like protein
• IMP1-LIKE
• mitochondrial inner membrane protease subunit 1

Background

The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrialintermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins.IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 (PubMed15814844)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IMMP1L