ILVBL Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ILVBL Antibody [NBP2-49524] - Staining of human cell line MCF7 shows localization to the Golgi apparatus & vesicles.

Immunohistochemistry: ILVBL Antibody [NBP2-49524] - Staining of human stomach shows strong cytoplasmic positivity with granular pattern in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ILVBL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ILVBL Antibody - BSA Free (NBP2-49524) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ILVBL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ILVBL Recombinant Protein Antigen (NBP2-49524PEP)

Reactivity Notes

Mouse (85%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ILVBL Antibody - BSA Free

• acetolactate synthase homolog
• acetolactate synthase-like protein
• AHASFLJ39061,209L8
• EC 2.2.1
• EC 2.2.1.-
• ILV2H
• ilvB (bacterial acetolactate synthase)-like
• IlvB-like protein
• MGC1269
• MGC19535

Background

The protein encoded by the ILVBL gene shares similarity with several thiamine pyrophosphate-binding proteins identified inbacteria, yeast, and plants. The highest degree of similarity is found with bacterial acetolactate synthases (AHAS),which are enzymes that catalyze the first step in branched-chain amino acid biosynthesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ILVBL