SCARA3 Antibody

Images

 
Western Blot: SCARA3 Antibody [NBP2-13286] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SCARA3 Antibody [NBP2-13286] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Western Blot: SCARA3 Antibody [NBP2-13286] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCARA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNNCSFCHEAGQLGPEIRKLQEELEGIQKLLLAQEVQLDQTLQAQEVLST TSRQISQEMGSCSFSIHQVNQSLGLFLAQVRGWQATTAGLDLSLKDLTQE CYDVKAAVHQINFTVGQTSEWIHGIQRKTDEETLTLQKIVTDWQNYTRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCARA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCARA3 Protein (NBP2-13286PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCARA3 Antibody

  • APC7
  • CSR1
  • CSRCellular stress response gene protein
  • macrophage scavenger receptor-like 1
  • MSLR1cellular stress response protein
  • MSRL1
  • scavenger receptor class A member 3
  • scavenger receptor class A, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13286
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SCARA3 Antibody (NBP2-13286) (0)

There are no publications for SCARA3 Antibody (NBP2-13286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCARA3 Antibody (NBP2-13286) (0)

There are no reviews for SCARA3 Antibody (NBP2-13286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCARA3 Antibody (NBP2-13286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCARA3 Products

Bioinformatics Tool for SCARA3 Antibody (NBP2-13286)

Discover related pathways, diseases and genes to SCARA3 Antibody (NBP2-13286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCARA3 Antibody (NBP2-13286)

Discover more about diseases related to SCARA3 Antibody (NBP2-13286).
 

Pathways for SCARA3 Antibody (NBP2-13286)

View related products by pathway.

PTMs for SCARA3 Antibody (NBP2-13286)

Learn more about PTMs related to SCARA3 Antibody (NBP2-13286).

Blogs on SCARA3

There are no specific blogs for SCARA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCARA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARA3