IL12B Antibody (2H6)

Images

 
Western Blot: IL12B Antibody (2H6) [H00003593-M01] - IL12B monoclonal antibody (M01), clone 2H6. Analysis of IL12B expression in HepG2.
Sandwich ELISA: IL12B Antibody (2H6) [H00003593-M01] - Detection limit for recombinant GST tagged IL12B is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL12B Antibody (2H6) Summary

Immunogen
IL12B (NP_002178 229 a.a. - 328 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL12B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL12B Antibody (2H6)

  • CLMF p40
  • CLMF
  • CLMF2
  • Cytotoxic lymphocyte maturation factor 40 kDa subunit
  • IL-12 subunit p40
  • IL-12BNK cell stimulatory factor chain 2
  • interleukin 12, p40
  • interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocytematuration factor 2, p40)
  • interleukin-12 beta chain
  • interleukin-12 subunit beta
  • natural killer cell stimulatory factor, 40 kD subunit
  • NKSF
  • NKSF2IL12, subunit p40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
409-ML/CF
Species: Mu
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003593-M01
Species: Hu
Applications: WB, ELISA

Publications for IL12B Antibody (H00003593-M01) (0)

There are no publications for IL12B Antibody (H00003593-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL12B Antibody (H00003593-M01) (0)

There are no reviews for IL12B Antibody (H00003593-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL12B Antibody (H00003593-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL12B Products

Bioinformatics Tool for IL12B Antibody (H00003593-M01)

Discover related pathways, diseases and genes to IL12B Antibody (H00003593-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL12B Antibody (H00003593-M01)

Discover more about diseases related to IL12B Antibody (H00003593-M01).
 

Pathways for IL12B Antibody (H00003593-M01)

View related products by pathway.

PTMs for IL12B Antibody (H00003593-M01)

Learn more about PTMs related to IL12B Antibody (H00003593-M01).
 

Research Areas for IL12B Antibody (H00003593-M01)

Find related products by research area.

Blogs on IL12B

There are no specific blogs for IL12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL12B Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL12B
Uniprot