IL-6R alpha Antibody (9S8Q5)

• Reactivity: Mu
• Applications: WB, ELISA, Flow
• Clone: 9S8Q5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IL-6R alpha Antibody (9S8Q5) Summary

• Description: Novus Biologicals Rabbit IL-6R alpha Antibody (9S8Q5) (NBP3-33510) is a monoclonal antibody validated for use in WB, ELISA and Flow. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-357 of mouse IL-6R alpha (NP_034689.2).
  
  Sequence:
  LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IL6R
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Flow Cytometry 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for IL-6R alpha Antibody (9S8Q5)

• CD126
• gp80
• IL-6 R alpha
• IL6Q
• IL6R alpha
• IL-6R alpha
• IL6R
• IL-6R-1
• IL6RA
• IL-6Ra
• IL6RQ
• interleukin 6 receptor

Background

Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL6R