IL-3R alpha/CD123 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IL-3R alpha/CD123 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL3RA.
  
  

  Source: E. coli

  Amino Acid Sequence: PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IL3RA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86549.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-3R alpha/CD123 Recombinant Protein Antigen

• CD123 antigen
• CD123
• hIL3Ra
• hIL-3Ra
• IL-3 R alpha
• IL-3 receptor subunit alpha
• IL3R alpha
• IL-3R alpha
• IL-3R subunit alpha
• IL3R
• IL3RA
• IL-3Ra
• IL-3R-alpha
• IL3RAY
• IL3RX
• IL3RY
• interleukin 3 receptor, alpha (low affinity)
• interleukin-3 receptor subunit alpha
• MGC34174

Background

IL3RA (CD123) is a member of the immunoglobulin superfamily that is expressed on hematopoietic progenitors, basophils, mast cells, and megakaryocytes. This transmembrane glycoprotein can bind IL3 with low affinity but cannot transduce signals without association with additional protein partners. CD123 can complex with either common beta chain (CDw131) or the IL3RB chain to form high affinity heterodimeric IL3 receptors. CDw131 can complex with the Alpha subunits of the mouse IL3R, IL5R and GMCSFR to form high affinity receptors, while the IL3RB subunit is specific for IL3 but binds with low affinity. IL3 binding to the receptor complex can induce proliferation and differentiation of hematopoietic cells. It is present in Hematopoietic progenitors, basophils, mast cells and megakaryocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IL3RA