IL-32 Recombinant Protein Antigen

Images

 
There are currently no images for IL-32 Protein (NBP1-82560PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-32 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL32.

Source: E.coli

Amino Acid Sequence: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL32
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82560.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IL-32 Recombinant Protein Antigen

  • IL32
  • IL-32
  • IL-32alpha
  • IL-32beta
  • interleukin 32
  • interleukin-32 theta
  • interleukin-32
  • natural killer cell transcript 4
  • Natural killer cells protein 4
  • NK4
  • NK4IL-32delta
  • TAIF
  • TAIFa
  • TAIFb
  • TAIFc
  • TAIFd
  • TAIFIL-32gamma
  • Tumor necrosis factor alpha-inducing factor

Background

IL32 alfa is the shortest of the 4 isotypes of IL32 known, it is 134 amino acids ( kDa) protein, the IL32B (beta) is 188, IL32C is 168 and IL32D is 179 amino acids long proteins. Each subtype has an N-terminal segment and four kringle domains (NK4), that interact with several other proteins including the hepatic growth factor via c-met a tyrosine receptor kinase (5). IL-32 synergized with the intracellular nuclear oligomerization domain receptors (NOD1- and NOD2-specific muropeptides of peptidoglycans for the release of IL-1beta and IL-6. In contrast, IL-32 did not influence the cytokine production induced via TLRs (6). The anti-IL32 selective antibodies were made against an epitope that lies near the C-terminal end of the protein. The antibodies to IL32 are affinity purified on immobilized affinity based chromatography and characterized for applications in ELISA and Western blotting. The antiIL32 antibodies recognize a single band of IL32 in PC-IL32 samples. The IL32 antibodies do not cross react with other pro-inflammatory or anti-inflammatory interleukins, has also produced antibodies to other interleukins, interleukin receptors, cytokines and their receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

294-HG/CF
Species: Hu
Applications: BA
D6050
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
7625
Species: Mu
Applications: ELISA
NBP1-25966
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
201-LB/CF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for IL-32 Protein (NBP1-82560PEP) (0)

There are no publications for IL-32 Protein (NBP1-82560PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-32 Protein (NBP1-82560PEP) (0)

There are no reviews for IL-32 Protein (NBP1-82560PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-32 Protein (NBP1-82560PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-32 Products

Bioinformatics Tool for IL-32 Protein (NBP1-82560PEP)

Discover related pathways, diseases and genes to IL-32 Protein (NBP1-82560PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-32 Protein (NBP1-82560PEP)

Discover more about diseases related to IL-32 Protein (NBP1-82560PEP).
 

Pathways for IL-32 Protein (NBP1-82560PEP)

View related products by pathway.

PTMs for IL-32 Protein (NBP1-82560PEP)

Learn more about PTMs related to IL-32 Protein (NBP1-82560PEP).
 

Research Areas for IL-32 Protein (NBP1-82560PEP)

Find related products by research area.

Blogs on IL-32

There are no specific blogs for IL-32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-32 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL32