IL-31RA Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-31RA Antibody [NBP2-68866] - IL-31 RA Antibody [NBP2-68866] - Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-31RA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-31RA Antibody - BSA Free (NBP2-68866) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL31RA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  IL-31RA Recombinant Protein Antigen (NBP2-68866PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-31RA Antibody - BSA Free

• class I cytokine receptor
• CRL3
• CRL3Glmr
• Cytokine receptor-like 3
• GLMR
• GLM-R
• GLM-RMGC125346
• GP130 like receptor
• Gp130-like monocyte receptor
• Gp130-like receptor
• hGLM-R
• IL-31 RA
• IL-31 receptor subunit alpha
• IL-31R subunit alpha
• IL31RA
• IL-31RA
• IL-31RAGPLCRL
• IL-31R-alpha
• interleukin 31 receptor A
• interleukin-31 receptor subunit alpha
• PRO21384
• soluble type I cytokine receptor CRL3
• zcytoR17

Background

IL31RA is related to gp130 (IL6ST; MIM 600694), the common receptor subunit for IL6 (MIM 147620)-type cytokines. Oncostatin M receptor (OSMR; MIM 601743) and IL31RA form the heterodimeric receptor through which IL31 (MIM 609509) signals. Expression of IL31RA and OSMR mRNA is induced in activated monocytes, and both mRNAs are constitutively expressed in epithelial cells (Dillon et al., 2004 [PubMed 15184896]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL31RA