IL-21R Antibody

Western Blot: IL-21R Antibody [NBP1-87502] - Analysis in control (vector only transfected HEK293T lysate) and IL21R over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: IL-21R Antibody [NBP1-87502] - FISH analysis of BM aspirates using the A20/BLIMP1/SHGC-79576 Three Color Probe (Cancer Genetics Italia(TM)) and IL21R staining of a BM biopsied specimen. Green, red, and yellow signals represent BLIMP1, A20, and SHGC-79576, respectively. (c) >70% positivity of IL-21R in lymphoplasmacytic cells and plasma cells (original magnification x600). (d) <30% positivity of IL-21R in lymphoplasmacytic cells and plasma cells (original magnification x600). Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/bmri/2018/6728128/), licensed under a CC-BY license.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IL-21R Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL21R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-21R Antibody

• CD360 antigen
• CD360
• IL-21 R
• IL-21 receptor
• IL21R
• IL-21R
• interleukin 21 receptor
• interleukin-21 receptor
• MGC10967
• NILR
• Novel interleukin receptor

Background

IL21 Receptor is a novel cytokine related to IL-2 and IL-15 was recently identified and designated IL-21. The receptor for IL-21 (IL-21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL-21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL-21 signaling. Both IL-21R and the gc are necessary for the IL-21 function. IL-21 and its receptor activate JAK-STAT signaling pathway. IL-21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL-21 plays a role in the proliferation and maturation of NK, B and T cell populations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-21R Antibody (NBP1-87502)(1)

Publication using NBP1-87502

• Sekiguchi N, Nomoto J, Nagata A et al. Gene Expression Profile Signature of Aggressive WaldenstrOm Macroglobulinemia with Chromosome 6q Deletion Biomed Res Int. 2018-10-03 [PMID: 30402490] (IHC-P, Human)

Bioinformatics

• Gene Symbol: IL21R