IL-21 Antibody Summary
| Immunogen |
Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21. |
| Localization |
Secreted |
| Specificity |
Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Goat |
| Gene |
IL21 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunohistochemistry 1:500
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
10mM KHPO4, 0.14M NaCl and 1.0 mg/ml BSA |
| Preservative |
0.1% Sodium Azide |
| Concentration |
1.0 mg/ml |
| Purity |
Immunogen affinity purified |
Alternate Names for IL-21 Antibody
Background
A novel cytokine related to IL2 and IL15 was recently identified and designated IL21. IL21 has been found to be a powerful growth factor for naive B cells. The receptor for IL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessary for the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role in the proliferation and maturation of NK, B and T cell populations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Mu
Applications: ELISA, IHC
Publications for IL-21 Antibody (NB100-736) (0)
There are no publications for IL-21 Antibody (NB100-736).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-21 Antibody (NB100-736) (0)
There are no reviews for IL-21 Antibody (NB100-736).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IL-21 Antibody (NB100-736) (0)