IL-21 Antibody

Immunohistochemistry: IL-21 Antibody [NB100-736] - Goat antibody N-terminus of mouse IL-21.

Product Discontinued

IL-21 Antibody Summary

• Immunogen: Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21.
• Localization: Secreted
• Specificity: Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Goat
• Gene: IL21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:500

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 10mM KHPO4, 0.14M NaCl and 1.0 mg/ml BSA
• Preservative: 0.1% Sodium Azide
• Concentration: 1.0 mg/ml
• Purity: Immunogen affinity purified

Alternate Names for IL-21 Antibody

• CVID11
• IL21
• IL-21
• IL-21Za11interleukin-21
• interleukin 21
• interleukin-21 isoform
• Za11

Background

A novel cytokine related to IL2 and IL15 was recently identified and designated IL21. IL21 has been found to be a powerful growth factor for naive B cells. The receptor for IL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessary for the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role in the proliferation and maturation of NK, B and T cell populations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL21
• Entrez:
  • 60505(Mouse)