Orthogonal Strategies: Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - analysis in human lymph node and liver tissues using NBP2-38481 antibody. Corresponding IL18BP RNA-seq data are ...read more
Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human liver shows no cytoplasmic positivity in hepatocytes.
Novus Biologicals Rabbit IL-18 BPa/IL18BP Antibody - BSA Free (NBP2-38481) is a polyclonal antibody validated for use in IHC. Anti-IL-18 BPa/IL18BP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL18BP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for IL-18 BPa/IL18BP Antibody - BSA Free
IL18 BPa
IL-18 BPa
IL18BP
IL-18BP
IL18BPa
interleukin 18 binding protein
interleukin-18-binding protein
MC51L-53L-54L homolog gene product
tadekinig-alfa
Background
IL-18BP which binds to IL-18, also known as interferon-gamma inducing factor (IGIF) which is a pro-inflammatory cytokine that belongs to the IL-1 family (1). IL-18 is a pleiotropic factor involved in the regulation of both innate and acquired immune responses, playing a key role in autoimmune, inflammatory, and infectious diseases (2). Interleukin-18 binding protein (IL18-BP) is an inhibitor of the pro-inflammatory cytokine IL18. The recombinant forms of IL18BP did not exhibit species specificity and prevented interleukin-18 binding to its receptor. In addition, they inhibited interleukine-18 dependent IFN-gamma production from KG-1 cells effectively. These results suggest that the interleukin-18 binding protein may possess interleukine-18 antagonist activity (3). IL-18 plays an important role in host defense against microbial pathogens. Many poxviruses encode homologous IL-18BP that neutralizes IL-18 activity. Data show that IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for IL-18Ralpha (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for IL-18 BPa/IL18BP Antibody (NBP2-38481) (0)
There are no reviews for IL-18 BPa/IL18BP Antibody (NBP2-38481).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our IL-18 BPa/IL18BP Antibody - BSA Free and receive a gift card or discount.