IL-18 BPa/IL18BP Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - analysis in human lymph node and liver tissues using NBP2-38481 antibody. Corresponding IL18BP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human liver shows no cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-18 BPa/IL18BP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-18 BPa/IL18BP Antibody - BSA Free (NBP2-38481) is a polyclonal antibody validated for use in IHC. Anti-IL-18 BPa/IL18BP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL18BP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-18 BPa/IL18BP Protein (NBP2-38481PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-18 BPa/IL18BP Antibody - BSA Free

• IL18 BPa
• IL-18 BPa
• IL18BP
• IL-18BP
• IL18BPa
• interleukin 18 binding protein
• interleukin-18-binding protein
• MC51L-53L-54L homolog gene product
• tadekinig-alfa

Background

IL-18BP which binds to IL-18, also known as interferon-gamma inducing factor (IGIF) which is a pro-inflammatory cytokine that belongs to the IL-1 family (1). IL-18 is a pleiotropic factor involved in the regulation of both innate and acquired immune responses, playing a key role in autoimmune, inflammatory, and infectious diseases (2). Interleukin-18 binding protein (IL18-BP) is an inhibitor of the pro-inflammatory cytokine IL18. The recombinant forms of IL18BP did not exhibit species specificity and prevented interleukin-18 binding to its receptor. In addition, they inhibited interleukine-18 dependent IFN-gamma production from KG-1 cells effectively. These results suggest that the interleukin-18 binding protein may possess interleukine-18 antagonist activity (3). IL-18 plays an important role in host defense against microbial pathogens. Many poxviruses encode homologous IL-18BP that neutralizes IL-18 activity. Data show that IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for IL-18Ralpha (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-18 BPa/IL18BP Antibody (NBP2-38481)(1)

Publication using NBP2-38481

• Lin C, Chao H, Li Z et al. Omega-3 fatty acids regulate NLRP3 inflammasome activation and prevent behavior deficits after traumatic brain injury Exp Neurol. 2017-04-01 [PMID: 28077340] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: IL18BP
• Uniprot:
  • O95998()