IL-17RE Antibody (46N7E3) [DyLight 650]

• Reactivity: Hu
• Applications: WB, IHC
• Clone: 46N7E3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: DyLight 650

IL-17RE Antibody (46N7E3) [DyLight 650] Summary

• Description: This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
• Immunogen: amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IL17RE
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein G purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for IL-17RE Antibody (46N7E3) [DyLight 650]

• IL-17 RE
• IL-17 receptor E
• IL17RE
• IL-17RE
• Il25r
• interleukin 17 receptor E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL17RE