IL-17C Antibody Summary
| Immunogen |
IL17C (NP_037410.1, 1 a.a. - 197 a.a.) full-length human protein. MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV |
| Specificity |
IL17C - interleukin 17C, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
IL17C |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunohistochemistry (paraffin). |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-17C Antibody
Background
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: BA
Publications for IL-17C Antibody (H00027189-B01P) (0)
There are no publications for IL-17C Antibody (H00027189-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-17C Antibody (H00027189-B01P) (0)
There are no reviews for IL-17C Antibody (H00027189-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-17C Antibody (H00027189-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-17C Products
Research Areas for IL-17C Antibody (H00027189-B01P)
Find related products by research area.
|
Blogs on IL-17C