IL-15 Antibody (1H6) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
IL15 (AAH18149, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVT |
| Localization |
Isoform IL15 S48AA: Secreted. Isoform IL15 S21AA: Cytoplasm. Nucleus. (Isoform IL15 S21AA is not secreted but stored intracellularly, appearing in the nucleus and cytoplasmic components.) |
| Specificity |
IL15 - interleukin 15 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
IL15 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-15 Antibody (1H6)
Background
IL15 (114 amino acids) is a cytokine that regulates T and natural killer cell activation and proliferation. It has a predicted molecular mass of approximately 12.5 kDa. Human IL15 shares approximately 97% and 73% amino acid sequence identity with simian and mouse IL15, respectively. Both human and simian IL15 are active on mouse cells. IL15 was initially isolated from the simian kidney epithelial cell line CV1/EBNA. It has also been isolated from mouse and human cell sources. The cytokines IL15 and IL2 share many biological properties and stimulatory activities (T, B, and NK cells). Both IL15 and IL2 stimulate mouse CTLL2 cells. In activated peripheral blood T lymphocytes, IL2 is highly expressed but the expression of IL15 is not detectable. There is no sequence homology between IL15 and IL2, though computer modeling indicates both possess a four alpha helical bundle structure. IL15 competes for binding sites with IL2, as both IL2 and IL15 stimulate the growth of cells through the IL2 receptor. IL15 mRNA is expressed in many cell types and tissues including adherent peripheral blood mononuclear cells, fibroblasts, and epithelial cells, monocytes, placenta, and skeletal muscle. IL-15 (14-15 kD) is a member of the four alpha-helical bundle family of cytokines. It is very similar to IL-2, except that IL-15 has an IL-15 alpha receptor subunit. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules. This implies that IL-15 could be essential for the immune responses, allograft rejection, and the pathogenesis of autoimmune diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA
Publications for IL-15 Antibody (H00003600-M01) (0)
There are no publications for IL-15 Antibody (H00003600-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-15 Antibody (H00003600-M01) (0)
There are no reviews for IL-15 Antibody (H00003600-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-15 Antibody (H00003600-M01) (0)