Ikaros/IKZF1 Antibody - BSA Free

Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314] - Mouse Small Intestine Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Ikaros/IKZF1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Ikzf1 - N-terminal region. Peptide sequence: RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPG The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IKZF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Ikaros/IKZF1 Antibody - BSA Free

• DNA-binding protein Ikaros
• hIk-1
• IK1
• IK1LyF-1
• Ikaros (zinc finger protein)
• IKAROS family zinc finger 1 (Ikaros)
• Ikaros family zinc finger protein 1
• Ikaros
• IKAROSLymphoid transcription factor LyF-1
• IKZF1
• LYF1
• LyF-1
• LYF1PRO0758
• PRO0758
• zinc finger protein, subfamily 1A, 1 (Ikaros)
• ZNFN1A1
• ZNFN1A1CLL-associated antigen KW-6

Background

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ikaros/IKZF1 Antibody (NBP1-98314)(3)

Publications using NBP1-98314

• Wu J, Wang X, Zhang M et al. RXR Agonists Enhance Lenalidomide Anti-Myeloma Activity and T Cell Functions while Retaining Glucose-Lowering Effect Cells 2023-08-03 [PMID: 37566072]
• Wu J, Chu E, Paul B, Kang Y Mechanistic Studies and a Retrospective Cohort Study: The Interaction between PPAR Agonists and Immunomodulatory Agents in Multiple Myeloma Cancers 2022-10-27 [PMID: 36358696] (WB, Human)
• Sha Y, Wu J, Paul B et al. PPAR agonists attenuate lenalidomide's anti-myeloma activity in vitro and in vivo Cancer letters 2022-07-21 [PMID: 35872263]

Bioinformatics

• Gene Symbol: IKZF1
• Uniprot:
  • NP_033604(Mouse)