Ikaros/IKZF1 Antibody (4S10I3)

Western Blot: Ikaros/IKZF1 Antibody (4S10I3) [NBP3-16223] - Analysis of extracts of various cell lines, using Ikaros/IKZF1 Rabbit mAb (NBP3-16223) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: Ikaros/IKZF1 Antibody (4S10I3) [NBP3-16223] - Immunofluorescence analysis of Jurkat cells using Ikaros/IKZF1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Chromatin Immunoprecipitation: Ikaros/IKZF1 Antibody (4S10I3) [NBP3-16223] - Chromatin immunoprecipitation analysis of extracts of K-562 cells, using Ikaros/IKZF1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, ChIP
• Clone: 4S10I3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ikaros/IKZF1 Antibody (4S10I3) Summary

• Description: Novus Biologicals Rabbit Ikaros/IKZF1 Antibody (4S10I3) (NBP3-16223) is a recombinant monoclonal antibody validated for use in WB, ELISA, ICC/IF and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros/IKZF1 (Q13422). AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IKZF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ikaros/IKZF1 Antibody (4S10I3)

• DNA-binding protein Ikaros
• hIk-1
• IK1
• IK1LyF-1
• Ikaros (zinc finger protein)
• IKAROS family zinc finger 1 (Ikaros)
• Ikaros family zinc finger protein 1
• Ikaros
• IKAROSLymphoid transcription factor LyF-1
• IKZF1
• LYF1
• LyF-1
• LYF1PRO0758
• PRO0758
• zinc finger protein, subfamily 1A, 1 (Ikaros)
• ZNFN1A1
• ZNFN1A1CLL-associated antigen KW-6

Background

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IKZF1