IGSF4A/SynCAM1/CADM1 Antibody

Images

 
Western Blot: IGSF4A/SynCAM1/CADM1 Antibody [H00023705-D01P] - Analysis of CADM1 expression in transfected 293T cell line by CADM1 polyclonal antibody.Lane 1: CADM1 transfected lysate(42.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF4A/SynCAM1/CADM1 Antibody Summary

Immunogen
CADM1 (AAH47021.1, 1 a.a. - 387 a.a.) full-length human protein. MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGLFSLTSSPRIK
Specificity
Reacts with cell adhesion molecule 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CADM1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGSF4A/SynCAM1/CADM1 Antibody

  • BL2
  • Cadm1
  • cell adhesion molecule 1
  • IgSF4
  • IGSF4A
  • IGSF4ADKFZp686F1789
  • IGSF4immunoglobulin superfamily, member 4D variant 2
  • Immunoglobulin superfamily member 4
  • immunoglobulin superfamily, member 4
  • Necl-2
  • NECL2MGC149785
  • nectin-like 2
  • Nectin-like protein 2
  • RA175
  • sgIGSF
  • Spermatogenic immunoglobulin superfamily
  • ST17
  • sTSLC-1
  • Synaptic cell adhesion molecule
  • SynCAM
  • SynCAM1
  • SYNCAMMGC51880
  • TSLC1
  • TSLC-1
  • TSLC1/Nectin-like 2/IGSF4
  • Tumor suppressor in lung cancer 1SYNCAM1

Background

Cell adhesion molecule 1 (CADM1) is a brain-specific, immunoglobulin domain. It functions as a homophilic cell adhesion molecule at the synapse. Full-length CADM1 has been shown to induce synaptic assembly, and can sufficiently create a functional postsynaptic response. Therefore, CADM1 antibodies may serve as useful tools for neuroscience and cell-cell interaction studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P) (0)

There are no publications for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P) (0)

There are no reviews for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF4A/SynCAM1/CADM1 Products

Research Areas for IGSF4A/SynCAM1/CADM1 Antibody (H00023705-D01P)

Find related products by research area.

Blogs on IGSF4A/SynCAM1/CADM1

There are no specific blogs for IGSF4A/SynCAM1/CADM1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF4A/SynCAM1/CADM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CADM1
Entrez
Uniprot