IGSF1 Antibody - BSA Free

Western Blot: IGSF1 Antibody [NBP1-59109] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP1-59109] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

IGSF1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1 (NP_991402). Peptide sequence LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGSF1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for IGSF1 Antibody - BSA Free

• CHTE
• IGCD1
• IGDC1
• IGDC1Pituitary gland-specific factor 2
• IGSF1
• immunoglobulin superfamily member 1
• immunoglobulin superfamily, member 1
• Immunoglobulin-like domain-containing protein 1
• InhBP
• Inhibin-binding protein
• KIAA0364p120
• MGC75490
• p120
• PGSF2
• PGSF2IGCD1

Background

Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGSF1 Antibody (NBP1-59109)(1)

Publication using NBP1-59109

• Tanaka,S. J. Mol. Endocrinol. 28 (1), 33-44. 2002-01-01 [PMID: 11854097]

Bioinformatics

• Gene Symbol: IGSF1
• Entrez:
  • 3547(Human)
  • 209268(Mouse)
• Uniprot:
  • Q8N6C5(Human)