IGSF1 Antibody

Images

 
Western Blot: IGSF1 Antibody [NBP1-59109] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP1-59109] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1 (NP_991402). Peptide sequence LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR.
Specificity
Appears to be specific to isoform 4
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGSF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-59109.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGSF1 Antibody

  • CHTE
  • IGCD1
  • IGDC1
  • IGDC1Pituitary gland-specific factor 2
  • IGSF1
  • immunoglobulin superfamily member 1
  • immunoglobulin superfamily, member 1
  • Immunoglobulin-like domain-containing protein 1
  • InhBP
  • Inhibin-binding protein
  • KIAA0364p120
  • MGC75490
  • p120
  • PGSF2
  • PGSF2IGCD1

Background

Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IGSF1 Antibody (NBP1-59109)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-59109 Applications Species
Tanaka,S. J. Mol. Endocrinol. 28 (1), 33-44. 2002 [PMID: 11854097]

Reviews for IGSF1 Antibody (NBP1-59109) (0)

There are no reviews for IGSF1 Antibody (NBP1-59109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF1 Antibody (NBP1-59109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF1 Products

Bioinformatics Tool for IGSF1 Antibody (NBP1-59109)

Discover related pathways, diseases and genes to IGSF1 Antibody (NBP1-59109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF1 Antibody (NBP1-59109)

Discover more about diseases related to IGSF1 Antibody (NBP1-59109).
 

Pathways for IGSF1 Antibody (NBP1-59109)

View related products by pathway.

PTMs for IGSF1 Antibody (NBP1-59109)

Learn more about PTMs related to IGSF1 Antibody (NBP1-59109).

Blogs on IGSF1

There are no specific blogs for IGSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF1
Entrez
Uniprot