IGFALS/ALS Antibody

Images

 
Independent Antibodies: Western Blot: IGFALS/ALS Antibody [NBP1-89118] - Analysis using Anti-IGFALS antibody NBP1-89118 (A) shows similar pattern to independent antibody NBP1-89117 (B).
Immunocytochemistry/ Immunofluorescence: IGFALS/ALS Antibody [NBP1-89118] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IGFALS/ALS Antibody [NBP1-89118] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IGFALS/ALS Antibody [NBP1-89118] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: IGFALS/ALS Antibody [NBP1-89118] - Staining of human gallbladder shows weak cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

IGFALS/ALS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFALS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGFALS/ALS Recombinant Protein Antigen (NBP1-89118PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFALS/ALS Antibody

  • ALS insulin-like growth factor binding protein complex acid labile chain
  • ALS
  • insulin-like growth factor binding protein, acid labile subunit
  • insulin-like growth factor-binding protein complex acid labile subunit

Background

The protein encoded by the IGFALS gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGFALS/ALS Antibody (NBP1-89118) (0)

There are no publications for IGFALS/ALS Antibody (NBP1-89118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFALS/ALS Antibody (NBP1-89118) (0)

There are no reviews for IGFALS/ALS Antibody (NBP1-89118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGFALS/ALS Antibody (NBP1-89118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFALS/ALS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFALS