IGF2BP1 Antibody

Images

 
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-83108] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGF2BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGF2BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGF2BP1 Protein (NBP1-83108PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGF2BP1 Antibody

  • Coding region determinant-binding protein
  • CRD-BP
  • CRDBPIGF-II mRNA-binding protein 1
  • IGF II mRNA binding protein 1
  • IMP1
  • IMP-1ZBP-1
  • insulin-like growth factor 2 mRNA binding protein 1
  • insulin-like growth factor 2 mRNA-binding protein 1
  • VICKZ family member 1
  • VICKZ1
  • ZBP1IGF2 mRNA-binding protein 1
  • Zip code-binding protein 1
  • Zipcode-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32505
Species: Hu
Applications: IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for IGF2BP1 Antibody (NBP1-83108) (0)

There are no publications for IGF2BP1 Antibody (NBP1-83108).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP1 Antibody (NBP1-83108) (0)

There are no reviews for IGF2BP1 Antibody (NBP1-83108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGF2BP1 Antibody (NBP1-83108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGF2BP1 Products

Bioinformatics Tool for IGF2BP1 Antibody (NBP1-83108)

Discover related pathways, diseases and genes to IGF2BP1 Antibody (NBP1-83108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGF2BP1 Antibody (NBP1-83108)

Discover more about diseases related to IGF2BP1 Antibody (NBP1-83108).
 

Pathways for IGF2BP1 Antibody (NBP1-83108)

View related products by pathway.

PTMs for IGF2BP1 Antibody (NBP1-83108)

Learn more about PTMs related to IGF2BP1 Antibody (NBP1-83108).

Blogs on IGF2BP1

There are no specific blogs for IGF2BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGF2BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP1