IGF-I/IGF-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: IGF-I/IGF-1 Antibody [NBP2-48922] - Staining of human rectum shows moderate positivity in plasma.

Immunohistochemistry-Paraffin: IGF-I/IGF-1 Antibody [NBP2-48922] - Staining of human endometrium shows moderate in plasma.

Immunohistochemistry-Paraffin: IGF-I/IGF-1 Antibody [NBP2-48922] - Staining of human kidney shows moderate positivity in plasma.

Immunohistochemistry-Paraffin: IGF-I/IGF-1 Antibody [NBP2-48922] - Staining of human placenta shows moderate positivity in plasma.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IGF-I/IGF-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
• Predicted Species: Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IGF-I/IGF-1 Recombinant Protein Antigen (NBP2-48922PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IGF-I/IGF-1 Antibody - BSA Free

• IBP1
• IGF1
• IGF-1
• IGF1A
• IGFI
• IGF-I
• IGF-IA
• IGF-IB
• insulin-like growth factor 1 (somatomedin C)
• insulin-like growth factor 1
• insulin-like growth factor I
• insulin-like growth factor IA
• insulin-like growth factor IB
• Mechano growth factor
• MGF
• Somatomedin A
• Somatomedin C
• somatomedin-C

Background

Insulin is a pancreatic hormone that regulates glucose uptake and the synthesis of protein and fat. The insulin like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth promoting activity. IGF1 (Insulin Like Growth Factor I) is a polypeptide growth factor, which stimulates the proliferation of a wide range of cell types including muscle, bone, and cartilage tissue. IGF1 functions as an autocrine regulator of growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGF1