IFITM3/Fragilis Antibody

Images

 
Orthogonal Strategies: Western Blot: IFITM3/Fragilis Antibody [NBP1-89401] - Analysis in human cell lines SK-MEL-30 and Caco-2 using anti-IFITM3 antibody. Corresponding IFITM3 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: IFITM3/Fragilis Antibody [NBP1-89401] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: IFITM3/Fragilis Antibody [NBP1-89401] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: IFITM3/Fragilis Antibody [NBP1-89401] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

IFITM3/Fragilis Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Specificity
Specificity of human IFITM3/Fragilis antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFITM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
IFITM3/Fragilis Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publication using NBP1-89401.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFITM3/Fragilis Antibody

  • 1-8U
  • Fragilis
  • IFITM3
  • interferon induced transmembrane protein 3 (1-8U)
  • interferon-induced transmembrane protein 3
  • Interferon-inducible protein 1-8U
  • IP15
  • mil-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010581-B01P
Species: Hu
Applications: WB, ELISA
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
AF2030
Species: Hu
Applications: WB, IHC
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01325
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32312
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32905
Species: Hu, Bv, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
H00002537-P01
Species: Hu
NBP2-23795
Species: Hu, Rt
Applications: WB
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF2566
Species: Mu
Applications: WB, IHC
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
DDX0390P-100
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
NBP2-67330
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for IFITM3/Fragilis Antibody (NBP1-89401)(1)

Reviews for IFITM3/Fragilis Antibody (NBP1-89401) (0)

There are no reviews for IFITM3/Fragilis Antibody (NBP1-89401). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFITM3/Fragilis Antibody (NBP1-89401) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFITM3/Fragilis Products

Bioinformatics Tool for IFITM3/Fragilis Antibody (NBP1-89401)

Discover related pathways, diseases and genes to IFITM3/Fragilis Antibody (NBP1-89401). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFITM3/Fragilis Antibody (NBP1-89401)

Discover more about diseases related to IFITM3/Fragilis Antibody (NBP1-89401).
 

Pathways for IFITM3/Fragilis Antibody (NBP1-89401)

View related products by pathway.

PTMs for IFITM3/Fragilis Antibody (NBP1-89401)

Learn more about PTMs related to IFITM3/Fragilis Antibody (NBP1-89401).

Blogs on IFITM3/Fragilis

There are no specific blogs for IFITM3/Fragilis, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFITM3/Fragilis Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFITM3