IFITM2 Antibody (1F2)

Western Blot: IFITM2 Antibody (1F2) [H00010581-M14] - Analysis of IFITM2 expression in HepG2 (Cat # L019V1).

Western Blot: IFITM2 Antibody (1F2) [H00010581-M14] - Analysis of IFITM2 expression in transfected 293T cell line by IFITM2 monoclonal antibody (M14), clone 1F2. Lane 1: IFITM2 transfected lysate (Predicted MW: 14.6 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: IFITM2 Antibody (1F2) [H00010581-M14] - Detection limit for recombinant GST tagged IFITM2 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

IFITM2 Antibody (1F2) Summary

• Immunogen: IFITM2 (NP_006426.1, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW
• Specificity: Reacts with interferon induced transmembrane protein 2 (1-8D).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IFITM2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFITM2 Antibody (1F2)

• 1-8D
• IFITM2
• interferon induced transmembrane protein 2 (1-8D)
• interferon-induced transmembrane protein 2
• Interferon-inducible protein 1-8D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFITM2
• Entrez:
  • 10581(Human)
• Uniprot:
  • NP_006426(Human)