ICEBERG Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse ICEBERG Antibody - Azide and BSA Free (H00059082-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
ICEBERG (NP_067546.1, 1 a.a. - 90 a.a.) full-length human protein. MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH |
| Specificity |
ICEBERG - ICEBERG caspase-1 inhibitor, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CARD18 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ICEBERG Antibody - Azide and BSA Free
Background
ICEBERG, also known as Caspase recruitment domain-containing protein 18, is a 90 amino acid protein that is 10 kDa, most often expressed in the heart and placenta, down-regulates the release of IL1B, and by interacting with caspase-1 and preventing its association with RIP2 inhibits the generation of IL-1-beta. This protein is being studied for its involvement in chronic lymphocytic leukemia. The ICEBERG protein has been linked to the NOD-like receptor signaling pathway where it interacts with CASP1, CARD8, CARD16, and CARD17.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for ICEBERG Antibody (H00059082-B01P) (0)
There are no publications for ICEBERG Antibody (H00059082-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ICEBERG Antibody (H00059082-B01P) (0)
There are no reviews for ICEBERG Antibody (H00059082-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ICEBERG Antibody (H00059082-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ICEBERG Products
Research Areas for ICEBERG Antibody (H00059082-B01P)
Find related products by research area.
|
Blogs on ICEBERG