ICAT/CTNNBIP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ICAT/CTNNBIP1 Antibody [NBP3-17057] - Analysis in human skin and liver tissues using Anti-CTNNBIP1 antibody. Corresponding CTNNBIP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ICAT/CTNNBIP1 Antibody [NBP3-17057] - Staining of human skin shows high expression.

Immunohistochemistry-Paraffin: ICAT/CTNNBIP1 Antibody [NBP3-17057] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ICAT/CTNNBIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ICAT/CTNNBIP1 Antibody - BSA Free (NBP3-17057) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR
• Predicted Species: Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTNNBIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ICAT/CTNNBIP1 Antibody - BSA Free

• beta-catenin-interacting protein ICAT
• catenin, beta interacting protein 1
• CTNNBIP1
• ICAT
• ICATbeta-interacting protein 1
• Inhibitor of beta-catenin and Tcf-4

Background

CTNNBIP1, or Beta-catenin-interacting protein 1, consists of a short 81 amino acid isoform that is approximately 9 kDa, and is involved in the negative regulation of the Wnt signaling pathway, and it also prevents CTNNB1 and TCF from interacting. Current research is being conducted on CTNNBIP1 and a number of diseases to determine the relationship between the two. Some of these disorders and diseases include: actinic cheilitis, nasopharyngitis, adenomatous polyposis coli, gastric cancer, cheilitis, esophagitis, esophageal squamous cell carcinoma, laryngitis, desmoid tumor, hepatocellular carcinoma, acute lymphoblastic leukemia, medulloblastoma, malignant glioma, duodenitis, wilms tumor, endometrial carcinoma, and polyposis. CTNNBIP1 is linked to the Wnt signaling pathway, where it interacts with JUP, CTNNB1, BEND5, CASP4, and CPVL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNBIP1