ICAT/CTNNBIP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR |
| Predicted Species |
Mouse (98%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CTNNBIP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ICAT/CTNNBIP1 Antibody - BSA Free
Background
CTNNBIP1, or Beta-catenin-interacting protein 1, consists of a short 81 amino acid isoform that is approximately 9 kDa, and is involved in the negative regulation of the Wnt signaling pathway, and it also prevents CTNNB1 and TCF from interacting. Current research is being conducted on CTNNBIP1 and a number of diseases to determine the relationship between the two. Some of these disorders and diseases include: actinic cheilitis, nasopharyngitis, adenomatous polyposis coli, gastric cancer, cheilitis, esophagitis, esophageal squamous cell carcinoma, laryngitis, desmoid tumor, hepatocellular carcinoma, acute lymphoblastic leukemia, medulloblastoma, malignant glioma, duodenitis, wilms tumor, endometrial carcinoma, and polyposis. CTNNBIP1 is linked to the Wnt signaling pathway, where it interacts with JUP, CTNNB1, BEND5, CASP4, and CPVL.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC
Publications for ICAT/CTNNBIP1 Antibody (NBP3-17057) (0)
There are no publications for ICAT/CTNNBIP1 Antibody (NBP3-17057).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ICAT/CTNNBIP1 Antibody (NBP3-17057) (0)
There are no reviews for ICAT/CTNNBIP1 Antibody (NBP3-17057).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ICAT/CTNNBIP1 Antibody (NBP3-17057) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ICAT/CTNNBIP1 Products
Research Areas for ICAT/CTNNBIP1 Antibody (NBP3-17057)
Find related products by research area.
|
Blogs on ICAT/CTNNBIP1