Recombinant Human ICAP-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ICAP-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-200 of Human ITGB1BP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Protein/Peptide Type
Recombinant Protein
Gene
ITGB1BP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ICAP-1 Protein

  • Bodenin
  • DKFZp686K08158
  • ICAP1
  • ICAP-1
  • ICAP-1alpha
  • ICAP-1B
  • ICAP1ICAP1AICAP1BICAP-1A
  • integrin beta 1 binding protein 1
  • integrin beta-1-binding protein 1
  • Integrin cytoplasmic domain-associated protein 1
  • integrin cytoplasmic domain-associated protein 1-alpha
  • integrin cytoplasmic domain-associated protein 1-beta
  • ITGB1BP1

Background

The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
AF1389
Species: Mu
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for ICAP-1 Recombinant Protein (H00009270-P01) (0)

There are no publications for ICAP-1 Recombinant Protein (H00009270-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICAP-1 Recombinant Protein (H00009270-P01) (0)

There are no reviews for ICAP-1 Recombinant Protein (H00009270-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICAP-1 Recombinant Protein (H00009270-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICAP-1 Products

Bioinformatics Tool for ICAP-1 Recombinant Protein (H00009270-P01)

Discover related pathways, diseases and genes to ICAP-1 Recombinant Protein (H00009270-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICAP-1 Recombinant Protein (H00009270-P01)

Discover more about diseases related to ICAP-1 Recombinant Protein (H00009270-P01).
 

Pathways for ICAP-1 Recombinant Protein (H00009270-P01)

View related products by pathway.

PTMs for ICAP-1 Recombinant Protein (H00009270-P01)

Learn more about PTMs related to ICAP-1 Recombinant Protein (H00009270-P01).
 

Research Areas for ICAP-1 Recombinant Protein (H00009270-P01)

Find related products by research area.

Blogs on ICAP-1

There are no specific blogs for ICAP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ICAP-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB1BP1
Entrez