ICA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ICA1 Antibody [NBP2-56868] - Staining of human cell line MCF7 shows localization to cytosol & vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFK
Specificity
Specificity of human ICA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ICA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ICA1 Recombinant Protein Antigen (NBP2-56868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ICA1 Antibody

  • diabetes mellitus type I autoantigen
  • ICA1
  • ICA69
  • ICAp69
  • ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen
  • islet cell autoantigen 1 (69kD)
  • islet cell autoantigen 1 isoform
  • islet cell autoantigen 1
  • islet cell autoantigen 1, 69kDa
  • p69

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56868
Species: Hu
Applications: ICC/IF

Publications for ICA1 Antibody (NBP2-56868) (0)

There are no publications for ICA1 Antibody (NBP2-56868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICA1 Antibody (NBP2-56868) (0)

There are no reviews for ICA1 Antibody (NBP2-56868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ICA1 Antibody (NBP2-56868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ICA1 Products

Bioinformatics Tool for ICA1 Antibody (NBP2-56868)

Discover related pathways, diseases and genes to ICA1 Antibody (NBP2-56868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICA1 Antibody (NBP2-56868)

Discover more about diseases related to ICA1 Antibody (NBP2-56868).
 

Pathways for ICA1 Antibody (NBP2-56868)

View related products by pathway.

PTMs for ICA1 Antibody (NBP2-56868)

Learn more about PTMs related to ICA1 Antibody (NBP2-56868).
 

Research Areas for ICA1 Antibody (NBP2-56868)

Find related products by research area.

Blogs on ICA1

There are no specific blogs for ICA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ICA1