ICA1 Antibody - BSA Free

Western Blot: ICA1 Antibody [NBP1-83124] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: ICA1 Antibody [NBP1-83124] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ICA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ICA1 Antibody - BSA Free (NBP1-83124) is a polyclonal antibody validated for use in IHC and WB. Anti-ICA1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ICA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ICA1 Protein (NBP1-83124PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ICA1 Antibody - BSA Free

• diabetes mellitus type I autoantigen
• ICA1
• ICA69
• ICAp69
• ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen
• islet cell autoantigen 1 (69kD)
• islet cell autoantigen 1 isoform
• islet cell autoantigen 1
• islet cell autoantigen 1, 69kDa
• p69

Background

ICA1 is a gene that codes for a protein that is an autoantigen and may play a role in neurotransmitter secretion and is expressed abundantly in the pancreas, heart and brain, with a length of 483 amino acids and a weight of approximately 55 kDa. Current studies are being done on several diseases and disorders related to this gene including diabetes mellitus, Sjogren's syndrome, rehumatiod arthritis, insulinoma, vitiligo, and thyroiditis. ICA1 has also been shown to have interactions with KRT33B, STK16, CNTF, MKKS, and MYC in pathways such as the type 1 diabetes mellitus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ICA1 Antibody (NBP1-83124)(1)

Publication using NBP1-83124

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ICA1