Hydroxyacid Oxidase-1/HAO-1 Antibody

Images

 
Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes while bile ducts were negative.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hydroxyacid Oxidase-1/HAO-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDL STSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hydroxyacid Oxidase-1/HAO-1 Protein (NBP2-14080PEP)
Publications
Read Publication using NBP2-14080.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hydroxyacid Oxidase-1/HAO-1 Antibody

  • (S)-2-hydroxy-acid oxidase
  • EC 1.1.3.15
  • Glycolate oxidase
  • GOX
  • GOX1MGC142227
  • GOXMGC142225
  • HAO1
  • HAO-1
  • HAOX1
  • hydroxyacid oxidase (glycolate oxidase) 1
  • hydroxyacid oxidase 1
  • Hydroxyacid Oxidase1
  • Hydroxyacid Oxidase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-53164
Species: Hu
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)(1)

Reviews for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080) (0)

There are no reviews for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Bioinformatics Tool for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Discover related pathways, diseases and genes to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Discover more about diseases related to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080).
 

Pathways for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

View related products by pathway.

PTMs for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Learn more about PTMs related to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080).

Blogs on Hydroxyacid Oxidase-1/HAO-1

There are no specific blogs for Hydroxyacid Oxidase-1/HAO-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hydroxyacid Oxidase-1/HAO-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAO1
Entrez