Hydroxyacid Oxidase-1/HAO-1 Antibody

Images

 
Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining in human liver and pancreas tissues using anti-HAO1 antibody. Corresponding HAO1 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Hydroxyacid Oxidase-1/HAO-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDL STSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Specificity
Specificity of human Hydroxyacid Oxidase-1/HAO-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hydroxyacid Oxidase-1/HAO-1 Protein (NBP2-14080PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP2-14080 in the following applications:

Publications
Read Publication using NBP2-14080.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hydroxyacid Oxidase-1/HAO-1 Antibody

  • (S)-2-hydroxy-acid oxidase
  • EC 1.1.3.15
  • Glycolate oxidase
  • GOX
  • GOX1MGC142227
  • GOXMGC142225
  • HAO1
  • HAO-1
  • HAOX1
  • hydroxyacid oxidase (glycolate oxidase) 1
  • hydroxyacid oxidase 1
  • Hydroxyacid Oxidase1
  • Hydroxyacid Oxidase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-92892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
H00342184-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31470
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF, KD
MAB1936
Species: Hu
Applications: WB, IP
NBP1-23000
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)(1)

Review for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-14080:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Hydroxyacid Oxidase-1/HAO-1 NBP2-14080
Enlarge
3
reviewed by:
Faye Doherty
IHC-P Mouse 07/01/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedLiver tissue
SpeciesMouse
LotR59499

Comments

CommentsAverage Antibody when tested in Mouse Liver, has clear staining patterns, however has minor background noise within the tissue.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Bioinformatics Tool for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Discover related pathways, diseases and genes to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Discover more about diseases related to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080).
 

Pathways for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

View related products by pathway.

PTMs for Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080)

Learn more about PTMs related to Hydroxyacid Oxidase-1/HAO-1 Antibody (NBP2-14080).

Blogs on Hydroxyacid Oxidase-1/HAO-1

There are no specific blogs for Hydroxyacid Oxidase-1/HAO-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Faye Doherty
07/01/2019
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol HAO1