Hyaluronan synthase 2 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 67-185 of human Hyaluronan synthase 2 (NP_005319.1). EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HAS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:100 - 1:500
|
| Theoretical MW |
63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Hyaluronan synthase 2 Antibody - BSA Free
Background
The HAS2 gene encodes a 552 amino acid long, 63 kDA hyaluronan synthase 2 protein that functions in hyaluronan/hyaluronic acid (HA) synthesis which is critical to the extracellular matrix. HAS2 is involved in hyaluronan metabolism, MPSII (Hunter syndrome), and MPS VI (Maroteaux-Lamy syndrome). HAS2 is also linked to arthropathy, fibrosarcoma, endometrial cancer, osteoarthritis, myeloma, benign tumors, breast cancer, ovarian cancer, and colon carcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, mIF
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Neut, WB
Species: Mu, Rt
Applications: WB, ELISA
Publications for Hyaluronan synthase 2 Antibody (NBP3-03787) (0)
There are no publications for Hyaluronan synthase 2 Antibody (NBP3-03787).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronan synthase 2 Antibody (NBP3-03787) (0)
There are no reviews for Hyaluronan synthase 2 Antibody (NBP3-03787).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hyaluronan synthase 2 Antibody (NBP3-03787) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hyaluronan synthase 2 Products
Research Areas for Hyaluronan synthase 2 Antibody (NBP3-03787)
Find related products by research area.
|
Blogs on Hyaluronan synthase 2