Hyaluronan synthase 2 Antibody - BSA Free

Western Blot: Hyaluronan synthase 2 Antibody [NBP3-03787] - Analysis of various lysates, using HAS2 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. xposure time: 180s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hyaluronan synthase 2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 67-185 of human Hyaluronan synthase 2 (NP_005319.1). EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:100 - 1:500
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hyaluronan synthase 2 Antibody - BSA Free

• EC 2.4.1.212
• HA synthase 2
• hyaluronan synthase 2
• Hyaluronate synthase 2
• Hyaluronic acid synthase 2
• MGC126241
• MGC126242

Background

The HAS2 gene encodes a 552 amino acid long, 63 kDA hyaluronan synthase 2 protein that functions in hyaluronan/hyaluronic acid (HA) synthesis which is critical to the extracellular matrix. HAS2 is involved in hyaluronan metabolism, MPSII (Hunter syndrome), and MPS VI (Maroteaux-Lamy syndrome). HAS2 is also linked to arthropathy, fibrosarcoma, endometrial cancer, osteoarthritis, myeloma, benign tumors, breast cancer, ovarian cancer, and colon carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAS2