Huntingtin Recombinant Protein Antigen

Images

 
There are currently no images for Huntingtin Protein (NBP1-89710PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

Huntingtin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTT.

Source: E. coli

Amino Acid Sequence: LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89710.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Huntingtin Recombinant Protein Antigen

  • HD protein
  • HD
  • HTT
  • huntingtin (Huntington disease)
  • Huntingtin
  • IT15
  • IT15HDHuntington disease protein

Background

Huntingtin protein (Htt) is a 348 kDa protein product of Huntington's disease (HD, IT15) gene. Huntington's disease is a neurodegenerative disorder caused by a mutation on the HD gene, producing a polyglutamin (polyQ) expansion on the N-terminus of Htt. The mutant Htt leads to cytotoxicity in the striatal neuron (1). This cytotoxicity is modulated by proteolytic cleavage with caspases and calpains, producing N-terminal polyQ fragments. A phosphorylation of Htt may also regulate the cleavage and cytotoxicity of mutant Htt (2). The wild-type Htt up-regulates transcription of brain-derived neurotrophic factor (BDNF), a pro-survival factor for striatal neurons. This suggests restoring wild-type Htt level and increasing BDNF expression level can be therapeutic treatment for Huntington's disease (3). Huntingtin is also cleaved by apopain, a cysteine protease product of death-gene for human, suggesting HD might be a disorder of inappropriate apoptosis (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
MEP00B
Species: Mu
Applications: ELISA
MAB7665
Species: Hu
Applications: IHC, WB
D6050
Species: Hu
Applications: ELISA
H00002303-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
DBD00
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
202-IL
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
2914-HT
Species: Hu
Applications: BA
DTM100
Species: Hu
Applications: ELISA
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
9134-TN
Species: Hu
Applications: BA

Publications for Huntingtin Protein (NBP1-89710PEP) (0)

There are no publications for Huntingtin Protein (NBP1-89710PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Huntingtin Protein (NBP1-89710PEP) (0)

There are no reviews for Huntingtin Protein (NBP1-89710PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Huntingtin Protein (NBP1-89710PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Huntingtin Products

Bioinformatics Tool for Huntingtin Protein (NBP1-89710PEP)

Discover related pathways, diseases and genes to Huntingtin Protein (NBP1-89710PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Huntingtin Protein (NBP1-89710PEP)

Discover more about diseases related to Huntingtin Protein (NBP1-89710PEP).
 

Pathways for Huntingtin Protein (NBP1-89710PEP)

View related products by pathway.

PTMs for Huntingtin Protein (NBP1-89710PEP)

Learn more about PTMs related to Huntingtin Protein (NBP1-89710PEP).
 

Research Areas for Huntingtin Protein (NBP1-89710PEP)

Find related products by research area.

Blogs on Huntingtin.

Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy
By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Huntingtin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HTT