HuC Antibody

Images

 
Western Blot: HuC Antibody [H00001995-B01P] - Analysis of ELAVL3 expression in rat brain.
Western Blot: HuC Antibody [H00001995-B01P] - Analysis of ELAVL3 expression in transfected 293T cell line by ELAVL3 polyclonal antibody. Lane 1: ELAVL3 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HuC Antibody Summary

Immunogen
ELAVL3 (AAH11875, 1 a.a. - 367 a.a.) full-length human protein. MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA
Specificity
ELAVL3 - ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ELAVL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HuC Antibody

  • DKFZp547J036
  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C)
  • ELAV-like protein 3
  • Hu antigen C
  • Hu-antigen C
  • HuC
  • HUCL
  • HUCParaneoplastic cerebellar degeneration-associated antigen
  • MGC20653
  • PLE21Paraneoplastic limbic encephalitis antigen 21

Background

A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
NBP2-38012
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00001995-B01P
Species: Hu, Rt
Applications: WB

Publications for HuC Antibody (H00001995-B01P) (0)

There are no publications for HuC Antibody (H00001995-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HuC Antibody (H00001995-B01P) (0)

There are no reviews for HuC Antibody (H00001995-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HuC Antibody (H00001995-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HuC Products

Bioinformatics Tool for HuC Antibody (H00001995-B01P)

Discover related pathways, diseases and genes to HuC Antibody (H00001995-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HuC Antibody (H00001995-B01P)

Discover more about diseases related to HuC Antibody (H00001995-B01P).
 

Pathways for HuC Antibody (H00001995-B01P)

View related products by pathway.

PTMs for HuC Antibody (H00001995-B01P)

Learn more about PTMs related to HuC Antibody (H00001995-B01P).
 

Research Areas for HuC Antibody (H00001995-B01P)

Find related products by research area.

Blogs on HuC

There are no specific blogs for HuC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HuC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELAVL3
Entrez
Uniprot