ELAVL4 Antibody (6B9)

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.Lane 1: ELAVL4 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.2 ug/ml.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9. Analysis of ELAVL4 expression in PC-12.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9 Analysis of ELAVL4 expression in IMR-32.

Sandwich ELISA: ELAVL4 Antibody (6B9) [H00001996-M01] - Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, KD
• Clone: 6B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

ELAVL4 Antibody (6B9) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
• Specificity: ELAVL4 - ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ELAVL4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELAVL4 Antibody (6B9)

• abnormal vision, Drosophila, homolog of, like-4
• ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
• HuD
• Paraneoplastic encephalomyelitis antigen HuD

Background

ELAVL4 may play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, includingVEGF and FOS mRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ELAVL4 Antibody (H00001996-M01)(1)

Publication using H00001996-M01

• Blennerhassett MG, Lourenssen SR, Parlow LRG et al. Analgesia and mouse strain influence neuromuscular plasticity in inflamed intestine. Neurogastroenterol Motil 2017-05-03 [PMID: 28466581]

Bioinformatics

• Gene Symbol: ELAVL4
• Entrez:
  • 1996(Human)
• OMIM:
  • 168360(Human)
• Uniprot:
  • NP_068771(Human)