ELAVL4 Antibody (6B9)


Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.Lane 1: ELAVL4 transfected lysate(40.4 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.2 ug/ml.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9. Analysis of ELAVL4 expression in PC-12.
Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9 Analysis of ELAVL4 expression in IMR-32.
Sandwich ELISA: ELAVL4 Antibody (6B9) [H00001996-M01] - Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary

Order Details

ELAVL4 Antibody (6B9) Summary

ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
ELAVL4 - ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • RNA Inhibition
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.
Read Publication using H00001996-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELAVL4 Antibody (6B9)

  • abnormal vision, Drosophila, homolog of, like-4
  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
  • HuD
  • Paraneoplastic encephalomyelitis antigen HuD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD

Publications for ELAVL4 Antibody (H00001996-M01)(1)

Reviews for ELAVL4 Antibody (H00001996-M01) (0)

There are no reviews for ELAVL4 Antibody (H00001996-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ELAVL4 Antibody (H00001996-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ELAVL4 Products

Bioinformatics Tool for ELAVL4 Antibody (H00001996-M01)

Discover related pathways, diseases and genes to ELAVL4 Antibody (H00001996-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELAVL4 Antibody (H00001996-M01)

Discover more about diseases related to ELAVL4 Antibody (H00001996-M01).

Pathways for ELAVL4 Antibody (H00001996-M01)

View related products by pathway.

PTMs for ELAVL4 Antibody (H00001996-M01)

Learn more about PTMs related to ELAVL4 Antibody (H00001996-M01).

Research Areas for ELAVL4 Antibody (H00001996-M01)

Find related products by research area.

Blogs on ELAVL4

There are no specific blogs for ELAVL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELAVL4 Antibody (6B9) and receive a gift card or discount.


Gene Symbol ELAVL4