Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA |
Clone | 6B9 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS |
Specificity | ELAVL4 - ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ELAVL4 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00001996-M01 | Applications | Species |
---|---|---|
Blennerhassett MG, Lourenssen SR, Parlow LRG et al. Analgesia and mouse strain influence neuromuscular plasticity in inflamed intestine. Neurogastroenterol Motil 2017 May 3 [PMID: 28466581] |
Secondary Antibodies |
Isotype Controls |
Diseases for ELAVL4 Antibody (H00001996-M01)Discover more about diseases related to ELAVL4 Antibody (H00001996-M01).
| Pathways for ELAVL4 Antibody (H00001996-M01)View related products by pathway.
|
PTMs for ELAVL4 Antibody (H00001996-M01)Learn more about PTMs related to ELAVL4 Antibody (H00001996-M01).
| Research Areas for ELAVL4 Antibody (H00001996-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.