HtrA3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HtrA3 Antibody [NBP2-56875] - Staining of human cell line SiHa shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HtrA3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTRA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HtrA3 Recombinant Protein Antigen (NBP2-56875PEP)

Reactivity Notes

Mouse 89%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HtrA3 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.108
• High-temperature requirement factor A3
• HTRA 3
• HtrA serine peptidase 3
• HTRA3
• Pregnancy-related serine protease
• probable serine protease HTRA3
• Prsp
• serine protease HTRA3
• Tasp

Background

HtrA3 belongs to the human high-temperature requirement factor A (HtrA) family. HtrA3 has two isoforms (long and short), which are produced by alternative splicing. Similar to HtrA1, HtrA3 binds to various TGF-beta proteins and inhibits the signaling of BMP-4, -2 and TGF-beta 1. HtrA3 does not inhibit signaling originated from a constitutively active BMP receptor, indicating that the inhibition occurs upstream of the cell surface receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTRA3