NDFIP2 Antibody - BSA Free

Western Blot: NDFIP2 Antibody [NBP1-81436] - Analysis in human cell line A-431.

Immunocytochemistry/Immunofluorescence: NDFIP2 Antibody [NBP1-81436] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.

Immunohistochemistry-Paraffin: NDFIP2 Antibody [NBP1-81436] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDFIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDFIP2 Antibody - BSA Free (NBP1-81436) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDFIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDFIP2 Protein (NBP1-81436PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDFIP2 Antibody - BSA Free

• FLJ25842
• KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07
• MAPK-activating protein PM04 PM05 PM06 PM07
• N4wbp5a
• Nedd4 family interacting protein 2
• NEDD4 family-interacting protein 2
• NEDD4 WW domain-binding protein 5A
• NF-kappa-B-activating protein 413
• Putative NF-kappa-B-activating protein 413

Background

NDFIP2, also known as NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, putative MAPK-activating protein PM04/PM05/PM06/PM07 and putative NF-kappa-B-activating protein 413, is a member of the Nedd4 family. NDFIP2 activates the HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2. NDFIP2 also recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. NDFIP2 may also play a role in modulating EGFR signaling and other cellular processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDFIP2