NDFIP2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NDFIP2 Antibody - BSA Free (NBP1-81436) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NDFIP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NDFIP2 Antibody - BSA Free
Background
NDFIP2, also known as NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, putative MAPK-activating protein PM04/PM05/PM06/PM07 and putative NF-kappa-B-activating protein 413, is a member of the Nedd4 family. NDFIP2 activates the HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2. NDFIP2 also recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. NDFIP2 may also play a role in modulating EGFR signaling and other cellular processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: InhibAct
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for NDFIP2 Antibody (NBP1-81436) (0)
There are no publications for NDFIP2 Antibody (NBP1-81436).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDFIP2 Antibody (NBP1-81436) (0)
There are no reviews for NDFIP2 Antibody (NBP1-81436).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NDFIP2 Antibody (NBP1-81436) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NDFIP2 Products
Research Areas for NDFIP2 Antibody (NBP1-81436)
Find related products by research area.
|
Blogs on NDFIP2