HSPH1/HSP105 Antibody


Western Blot: HSPH1/HSP105 Antibody [NBP1-89662] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HSPH1/HSP105 Antibody [NBP1-89662] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: HSPH1/HSP105 Antibody [NBP1-89662] - Staining of human testis shows strong cytoplasmic positivity in basal cells in seminiferus ducts.
Western Blot: HSPH1/HSP105 Antibody [NBP1-89662] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HSPH1/HSP105 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
Specificity of human, mouse, rat HSPH1/HSP105 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
HSPH1/HSP105 Lysate (NBP2-65690)
Control Peptide
HSPH1/HSP105 Protein (NBP1-89662PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HSPH1/HSP105 Antibody

  • Antigen NY-CO-25
  • heat shock 105kD beta
  • heat shock 105kDa protein 1
  • heat shock 105kDa/110kDa protein 1
  • Heat shock 110 kDa protein
  • heat shock protein 105 kDa
  • HSP105a
  • HSP105B
  • HSP105heat shock 105kD alpha
  • HSP110
  • HSPH1
  • KIAA0201DKFZp686M05240
  • NY-CO-25


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pl
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for HSPH1/HSP105 Antibody (NBP1-89662) (0)

There are no publications for HSPH1/HSP105 Antibody (NBP1-89662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPH1/HSP105 Antibody (NBP1-89662) (0)

There are no reviews for HSPH1/HSP105 Antibody (NBP1-89662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPH1/HSP105 Antibody (NBP1-89662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HSPH1/HSP105 Products

Bioinformatics Tool for HSPH1/HSP105 Antibody (NBP1-89662)

Discover related pathways, diseases and genes to HSPH1/HSP105 Antibody (NBP1-89662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPH1/HSP105 Antibody (NBP1-89662)

Discover more about diseases related to HSPH1/HSP105 Antibody (NBP1-89662).

Pathways for HSPH1/HSP105 Antibody (NBP1-89662)

View related products by pathway.

PTMs for HSPH1/HSP105 Antibody (NBP1-89662)

Learn more about PTMs related to HSPH1/HSP105 Antibody (NBP1-89662).

Blogs on HSPH1/HSP105

There are no specific blogs for HSPH1/HSP105, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSPH1/HSP105 Antibody and receive a gift card or discount.


Gene Symbol HSPH1