Immunocytochemistry/ Immunofluorescence: HSPH1/HSP105 Antibody [NBP1-89662] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Staining of human testis shows strong cytoplasmic positivity in seminiferous ducts.
Independent Antibodies: Analysis using Anti-HSPH1 antibody NBP1-89662 (A) shows similar pattern to independent antibody NBP2-55047 (B).
Novus Biologicals Rabbit HSPH1/HSP105 Antibody - BSA Free (NBP1-89662) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HSPH1/HSP105 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPH1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for HSPH1/HSP105 Antibody - BSA Free
Antigen NY-CO-25
heat shock 105kD beta
heat shock 105kDa protein 1
heat shock 105kDa/110kDa protein 1
Heat shock 110 kDa protein
heat shock protein 105 kDa
HSP105a
HSP105B
HSP105heat shock 105kD alpha
HSP110
HSPH1
KIAA0201DKFZp686M05240
NY-CO-25
Background
The heat shock proteins (HSPs) comprise a group of highly conserved, abundantly expressed proteins with diverse functions, including the assembly and sequestering of multiprotein complexes, transportation of nascent polypeptide chains across cellular membranes and regulation of protein folding. Heat shock proteins (also known as molecular chaperones) fall into six general families: HSP 90, HSP 70, HSP 60, the low molecular weight HSPs, the immunophilins and the HSP 110 family. The HSP 110 family (also known as the HSP 105 family) is composed of HSP 105, Apg-1 and Apg-2. HSP 105 is a testis-specific and HSP 90-related protein. Research indicates that HSP 105 is specifically localized in the germ cells and may translocate into the nucleus after heat shock. It is suggested that HSP 105 may contribute to the stabilization of p53 proteins in the cytoplasm of the germ cells, preventing the potential induction of apoptosis by p53.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HSPH1/HSP105 Antibody - BSA Free and receive a gift card or discount.