HSPA8/HSC71/Hsc70 Antibody (0J2Z9)

Western Blot: HSPA8/HSC71/Hsc70 Antibody (0J2Z9) [NBP3-15262] - Western blot analysis of extracts of various cell lines, using HSPA8/HSC71/Hsc70 Rabbit mAb (NBP3-15262) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 0J2Z9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HSPA8/HSC71/Hsc70 Antibody (0J2Z9) Summary

• Description: Novus Biologicals Rabbit HSPA8/HSC71/Hsc70 Antibody (0J2Z9) (NBP3-15262) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 547-646 of human HSPA8/HSC71/Hsc70 (P11142). FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HSPA8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HSPA8/HSC71/Hsc70 Antibody (0J2Z9)

• Heat shock 70 kDa protein 8
• heat shock 70kD protein 8
• heat shock 70kDa protein 8
• heat shock cognate 71 kDa protein
• heat shock cognate protein 54
• heat shock cognate protein, 71-kDa
• HSC54
• HSC70
• HSC70heat shock 70kd protein 10
• HSC71
• HSP71
• HSP73
• HSP73constitutive heat shock protein 70
• HSPA10
• HSPA8
• LAP1
• lipopolysaccharide-associated protein 1
• LPS-associated protein 1
• MGC131511
• MGC29929
• NIP71
• N-myristoyltransferase inhibitor protein 71

Background

Hsp73 is a normal cell constituent which is synthesized in increased abundance under adverse environmental circumstances, such as non-physiological temperatures or treatment with amino acid analogues (1). Data has shown a molecular mechanism for cytokine-mediated posttranscriptional regulation of Bim mRNA by Hsc70, which binds to AU-rich elements (AREs) in the 3'-untranslated region of specific mRNAs and enhances their stability. The RNA binding potential of Hsc70 is regulated by cochaperones including Bag-4 (also SODD), CHIP, Hip, and Hsp40 (2). Hsp73 protein expression was detected in the cytoplasm of melanoma cells in primary tumors and metastases. In primary melanomas, the proportion of Hsp73 protein expressing cells correlated with tumor thickness which was found to be statistically significant (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSPA8