DNAJC6 Antibody

Images

 
Western Blot: DNAJC6 Antibody [NBP1-81507] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DNAJC6 Antibody [NBP1-81507] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAJC6 Antibody [NBP1-81507] - Staining in human cerebral cortex and pancreas tissues using anti-DNAJC6 antibody. Corresponding DNAJC6 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: DNAJC6 Antibody [NBP1-81507] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DNAJC6 Antibody [NBP1-81507] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DNAJC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Specificity
Specificity of human DNAJC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAJC6 Protein (NBP1-81507PEP)
Publications
Read Publication using
NBP1-81507 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (Roosen et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC6 Antibody

  • DJC6
  • DnaJ (Hsp40) homolog, subfamily B, member 6
  • DnaJ (Hsp40) homolog, subfamily C, member 6
  • DnaJ homolog subfamily C member 6
  • EC 3.1.3.48
  • KIAA0473auxilin
  • MGC129914
  • MGC129915
  • MGC48436
  • putative tyrosine-protein phosphatase auxilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
MAB847
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6918
Species: Hu
Applications: WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-Fr, S-ELISA
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92649
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-46506
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DNAJC6 Antibody (NBP1-81507)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-81507 Applications Species
Roosen DA, Landeck N, Conti M, Smith N Mutations in Auxilin cause parkinsonism via impaired clathrin-mediated trafficking at the Golgi apparatus and synapse BioRxiv (WB, Mouse) WB Mouse

Reviews for DNAJC6 Antibody (NBP1-81507) (0)

There are no reviews for DNAJC6 Antibody (NBP1-81507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC6 Antibody (NBP1-81507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC6 Products

Bioinformatics Tool for DNAJC6 Antibody (NBP1-81507)

Discover related pathways, diseases and genes to DNAJC6 Antibody (NBP1-81507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC6 Antibody (NBP1-81507)

Discover more about diseases related to DNAJC6 Antibody (NBP1-81507).
 

Pathways for DNAJC6 Antibody (NBP1-81507)

View related products by pathway.

Blogs on DNAJC6

There are no specific blogs for DNAJC6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC6