Independent Antibodies: Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Analysis using Anti-ST13 antibody NBP2-47427 (A) shows similar pattern to independent antibody NBP2-48865 (B).
Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human kidney.
Immunohistochemistry: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Independent Antibodies: Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human colon, kidney, ovary and testis using Anti-ST13 antibody NBP2-47427 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human testis.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human colon.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human ovary.
Hsp70 interacting protein HIP Antibody - BSA Free Summary
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Canine reactivity reported in scientific literature (PMID:32926463)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Hsp70 interacting protein HIP Antibody - BSA Free
AAG2
aging-associated protein 2
FAM10A1FAM10A4
heat shock 70kD protein binding protein
Hip
HIPFLJ27260
HOP
hsc70-interacting protein
Hsp70-interacting protein
HSPABP1
P48MGC129952
PRO0786
Progesterone receptor-associated p48 protein
Protein FAM10A1
Putative tumor suppressor ST13
Renal carcinoma antigen NY-REN-33
SNC6HSPABP
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
Suppression of tumorigenicity 13 protein
Background
Hsp70 interacting protein HIP is encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Hsp70 interacting protein HIP Antibody (NBP2-47427) (0)
There are no reviews for Hsp70 interacting protein HIP Antibody (NBP2-47427).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Hsp70 interacting protein HIP Antibody - BSA Free and receive a gift card or discount.