Hsp70 interacting protein HIP Antibody

Images

 
Independent Antibodies: Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Analysis using Anti-ST13 antibody NBP2-47427 (A) shows similar pattern to independent antibody NBP2-48865 (B).
Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human kidney.
Immunohistochemistry: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Independent Antibodies: Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human colon, kidney, ovary and testis using Anti-ST13 antibody NBP2-47427 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human testis.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human colon.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human ovary.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Hsp70 interacting protein HIP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Specificity
Specificity of human Hsp70 interacting protein HIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Hsp70 interacting protein HIP Protein (NBP2-47427PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hsp70 interacting protein HIP Antibody

  • AAG2
  • aging-associated protein 2
  • FAM10A1FAM10A4
  • heat shock 70kD protein binding protein
  • Hip
  • HIPFLJ27260
  • HOP
  • hsc70-interacting protein
  • Hsp70-interacting protein
  • HSPABP1
  • P48MGC129952
  • PRO0786
  • Progesterone receptor-associated p48 protein
  • Protein FAM10A1
  • Putative tumor suppressor ST13
  • Renal carcinoma antigen NY-REN-33
  • SNC6HSPABP
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
  • suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
  • Suppression of tumorigenicity 13 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90268
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00010963-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-75440
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, Gp, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-57587
Species: Hu, Mu, Rt, Bv, Pm, Rb, Xp
Applications: WB, IHC, IHC-P, KD
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-67168
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC

Publications for Hsp70 interacting protein HIP Antibody (NBP2-47427) (0)

There are no publications for Hsp70 interacting protein HIP Antibody (NBP2-47427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Antibody (NBP2-47427) (0)

There are no reviews for Hsp70 interacting protein HIP Antibody (NBP2-47427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hsp70 interacting protein HIP Antibody (NBP2-47427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Hsp70 interacting protein HIP Products

Bioinformatics Tool for Hsp70 interacting protein HIP Antibody (NBP2-47427)

Discover related pathways, diseases and genes to Hsp70 interacting protein HIP Antibody (NBP2-47427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hsp70 interacting protein HIP Antibody (NBP2-47427)

Discover more about diseases related to Hsp70 interacting protein HIP Antibody (NBP2-47427).
 

Pathways for Hsp70 interacting protein HIP Antibody (NBP2-47427)

View related products by pathway.

PTMs for Hsp70 interacting protein HIP Antibody (NBP2-47427)

Learn more about PTMs related to Hsp70 interacting protein HIP Antibody (NBP2-47427).
 

Research Areas for Hsp70 interacting protein HIP Antibody (NBP2-47427)

Find related products by research area.

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hsp70 interacting protein HIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST13